PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn216541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 351aa    MW: 38281.9 Da    PI: 6.885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn216541genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.2e-13107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r   + Rt+ q+ s+ qky
       Achn216541 107 PWTEEEHRLFLIGLHKLGKGDWRGISRSYVTSRTPTQVASHAQKY 151
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.727100156IPR017930Myb domain
SuperFamilySSF466896.65E-17102157IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-17103154IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.9E-10104150IPR009057Homeodomain-like
SMARTSM007171.8E-9104154IPR001005SANT/Myb domain
CDDcd001678.80E-9107152No hitNo description
PfamPF002491.2E-10107151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPW RGGGGNCVKL FGVRLTDGSI IKKSASMGNL SAHYHSSSSA  60
ADSPNPSSPS SDPIRDPIHV PDGYLSDDPA HATCSTNRRV ERKKGVPWTE EEHRLFLIGL  120
HKLGKGDWRG ISRSYVTSRT PTQVASHAQK YFIRHSNATR RKRRSSLFDM VPEMGTDQPT  180
VPEDQFMLPP SQAVDSDTIN SLPSLKLSLS QEFEPMEAPS DEKVEEPKET VTPRGEIPTL  240
VPAFFSAFLP VPFAMWPSNT APPPEEEKVA ETFHHQVLRP TPVIPKEPVN VDQLVGMSQL  300
NLGEAETGHV EPSLSLNLLG APSRPSAFHA STPANKSDLS EGESNVIQAV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426881.11e-159hypothetical protein CICLE_v10025950mg
TrEMBLV4SSM01e-159V4SSM0_9R
STRINGGLYMA13G43120.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117701922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-100MYB_related family protein